frontlinemarketingacademyreviews.com information

domain frontlinemarketingacademyreviews.com
appraised value -
domain birthday 01-Jul-2013
age4 year(s)
appraisal accuracy80%
backed by dealsNo
backed by appraisalNo
domain rating-
TLD ratingAA
Google pagerank-
SLDfrontlinemarketingacademyreviews
keywords frontlinemarketingacademyreviews
keywords language (0%)
Other languages-
first mentioned in-

frontlinemarketingacademyreviews.com categorization

topics
tags

frontlinemarketingacademyreviews.com search volume in Bing, Google & Yahoo

Global searches for frontlinemarketingacademyreviews.com0
Global approximate CPC frontlinemarketingacademyreviews.com3.93 USD
Global competition for frontlinemarketingacademyreviews.com54% (medium)
 
Global searches for "frontlinemarketingacademyreviews"0
Global approximate CPC "frontlinemarketingacademyreviews"0.19 USD
Global competition for "frontlinemarketingacademyreviews"75% (high)
 
Global searches for "frontlinemarketingacademyreviews"0
Global approximate CPC "frontlinemarketingacademyreviews"0.19 USD
Global competition for "frontlinemarketingacademyreviews"75% (high)
Local searches for frontlinemarketingacademyreviews.com0
Local approximate CPC frontlinemarketingacademyreviews.com3.93 USD
Local competition for frontlinemarketingacademyreviews.com54% (medium)
 
Local searches for "frontlinemarketingacademyreviews"0
Local approximate CPC "frontlinemarketingacademyreviews"0.19 USD
Local competition for "frontlinemarketingacademyreviews"75% (high)
 
Local searches for "frontlinemarketingacademyreviews"0
Local approximate CPC "frontlinemarketingacademyreviews"0.19 USD
Local competition for "frontlinemarketingacademyreviews"75% (high)

frontlinemarketingacademyreviews.com traffic estimates

alexa traffic rank16,618,885
estimated daily visitors27
development value0 USD
overture value-

frontlinemarketingacademyreviews.com direct navigation estimates

monthly type-ins810
monthly parking revenue0 USD
currently parked at-
parking recommendationBodis.com
parking value of the domain1 USD

Marshall Index data

Marshall Index value-
Marshall Index amount of media0
Marshall Index term page-

frontlinemarketingacademyreviews.com trademarks

trademark risk%
udrpsNo UDRPS found

frontlinemarketingacademyreviews.com affected trademarks

Trademark Company Source Active

List of deals for frontlinemarketingacademyreviews.com

Domain Price Currency Date Source

Other extensions for frontlinemarketingacademyreviews.com

Buy this domain?

email the owner of frontlinemarketingacademyreviews.com email
ask a broker to handle a purchase upmarketDNS
Buy frontlinemarketingacademyreviews.com on

Sell this domain

ask a broker to handle a purchase upmarketDNS
sell this domain on Sedo / Bido / Flippa

Develop this domain

ask for an individual solution by Aspekt
find a contractor on oDesk
auto develop on Epik / Devname / Vortalbuilder

Similar domains for sale

Synonym domains with frontlinemarketingacademyreviews.com

Acronym meaning

Additional information for frontlinemarketingacademyreviews.com

frontlinemarketingacademyreviews.com is not listed in DMOZ