
appraised value
domain birthday -
appraisal accuracy-
backed by deals-
backed by appraisal-
domain rating-
TLD ratingA
Google pagerank-
keywords language-
Other languages-
first mentioned in- categorization

tags search volume in Bing, Google & Yahoo

Global searches for
Global approximate CPC
Global competition for
Global searches for "crystalsmineralspecimensreviewstoremay"-
Global approximate CPC "crystalsmineralspecimensreviewstoremay"-
Global competition for "crystalsmineralspecimensreviewstoremay"-
Global searches for ""-
Global approximate CPC ""-
Global competition for ""-
Local searches for
Local approximate CPC
Local competition for
Local searches for "crystalsmineralspecimensreviewstoremay"-
Local approximate CPC "crystalsmineralspecimensreviewstoremay"-
Local competition for "crystalsmineralspecimensreviewstoremay"-
Local searches for ""-
Local approximate CPC ""-
Local competition for ""- traffic estimates

alexa traffic rank-
estimated daily visitors-
development value-
overture value- direct navigation estimates

monthly type-ins-
monthly parking revenue-
currently parked at-
parking recommendation-
parking value of the domain-

Marshall Index data

Marshall Index value-
Marshall Index amount of media-
Marshall Index term page- trademarks

trademark risk-
udrps- affected trademarks

Trademark Company Source Active

List of deals for

Domain Price Currency Date Source

Other extensions for

Buy this domain?

email the owner of email
ask a broker to handle a purchase upmarketDNS
Buy on

Sell this domain

ask a broker to handle a purchase upmarketDNS
sell this domain on Sedo / Bido / Flippa

Develop this domain

ask for an individual solution by Aspekt
find a contractor on oDesk
auto develop on Epik / Devname / Vortalbuilder

Similar domains for sale

Synonym domains with

Acronym meaning

Additional information for