quickandeasyhealthyfamilyrecipes.com information

domain quickandeasyhealthyfamilyrecipes.com
appraised value -
domain birthday 17-Aug-2013
age11 year(s)
appraisal accuracy80%
backed by dealsNo
backed by appraisalNo
domain rating-
TLD ratingAA
SLDquickandeasyhealthyfamilyrecipes
keywords quickandeasyhealthyfamilyrecipes
keywords language (0%)
Other languages-
first mentioned in-

quickandeasyhealthyfamilyrecipes.com categorization

topics
tags

quickandeasyhealthyfamilyrecipes.com search volume in Bing, Google & Yahoo

Global searches for quickandeasyhealthyfamilyrecipes.com0
Global approximate CPC quickandeasyhealthyfamilyrecipes.com3.06 USD
Global competition for quickandeasyhealthyfamilyrecipes.com63% (medium)
 
Global searches for "quickandeasyhealthyfamilyrecipes"0
Global approximate CPC "quickandeasyhealthyfamilyrecipes"8.57 USD
Global competition for "quickandeasyhealthyfamilyrecipes"12% (low)
 
Global searches for "quickandeasyhealthyfamilyrecipes"0
Global approximate CPC "quickandeasyhealthyfamilyrecipes"8.57 USD
Global competition for "quickandeasyhealthyfamilyrecipes"12% (low)
Local searches for quickandeasyhealthyfamilyrecipes.com0
Local approximate CPC quickandeasyhealthyfamilyrecipes.com3.06 USD
Local competition for quickandeasyhealthyfamilyrecipes.com63% (medium)
 
Local searches for "quickandeasyhealthyfamilyrecipes"0
Local approximate CPC "quickandeasyhealthyfamilyrecipes"8.57 USD
Local competition for "quickandeasyhealthyfamilyrecipes"12% (low)
 
Local searches for "quickandeasyhealthyfamilyrecipes"0
Local approximate CPC "quickandeasyhealthyfamilyrecipes"8.57 USD
Local competition for "quickandeasyhealthyfamilyrecipes"12% (low)

quickandeasyhealthyfamilyrecipes.com traffic estimates

alexa traffic rank0
estimated daily visitors0
development value0 USD

quickandeasyhealthyfamilyrecipes.com direct navigation estimates

monthly type-ins0
monthly parking revenue0 USD
currently parked at-
parking recommendationBodis.com
parking value of the domain0 USD

quickandeasyhealthyfamilyrecipes.com trademarks

trademark risk%
udrpsNo UDRPS found

quickandeasyhealthyfamilyrecipes.com affected trademarks

Trademark Company Source Active

List of deals for quickandeasyhealthyfamilyrecipes.com

Domain Price Currency Date Source

Other extensions for quickandeasyhealthyfamilyrecipes.com

Buy this domain?

email the owner of quickandeasyhealthyfamilyrecipes.com email
ask a broker to handle a purchase upmarketDNS
Buy quickandeasyhealthyfamilyrecipes.com on

Sell this domain

ask a broker to handle a purchase upmarketDNS
sell this domain on Sedo / Bido / Flippa

Develop this domain

ask for an individual solution by Aspekt
find a contractor on oDesk
auto develop on Epik / Devname / Vortalbuilder

Similar domains for sale

Synonym domains with quickandeasyhealthyfamilyrecipes.com

Acronym meaning

Additional information for quickandeasyhealthyfamilyrecipes.com